Immunogen
Synthetic peptide directed towards the N terminal region of human ANXA7
Biochem/physiol Actions
ANXA7 is a calcium-dependent, phospholipid-binding protein that belongs to the annexin family. It is expressed as 47 and 51 kDa isoforms that are involved in membrane fusion processes. The 47 kDa isoform is important for the calcium-dependent vesicle release in red blood cells that might confer protection against the complement components.
Sequence
Synthetic peptide located within the following region: MSYPGYPPTGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV36584-100UL