Immunogen
Synthetic peptide directed towards the middle region of human AOC2
Application
Anti-AOC2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Amine oxidase, copper containing 2 (retina-specific) belongs to the copper amine oxidases family that converts amines to aldehydes and ammonia in the presence of copper and quinone as cofactors. AOC2 degrades dopamine, histamine and putrescine and modulates the signal transmission in the retina. The AOC2 gene mutations may cause hereditary ocular diseases.
Sequence
Synthetic peptide located within the following region: QATMVDIHILVGKGAVQLLPGAVCVFEEAQGLPLRRHHNYLQNHFYGGLA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51432510
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV45055-100UL
