General description
The protein encoded by this gene interacts with the cytoplasmic domains of amyloid beta (A4) precursor protein and amyloid beta (A4) precursor-like protein 2. This protein contains two phosphotyrosine binding (PTB) domains, which are thought to function in signal transduction. (provided by RefSeq)
Immunogen
APBB2 (ABM85666.1, 1 a.a. ~ 329 a.a) full-length human protein.
Sequence
MAEEDLAPGKSSVAVNNCIRQLSYCKNDIRDTVGIWGEGKDMYLILENDMLSLVDPMDRSVLHSQPIVSIRVWGVGRDNGRDFAYVARDKDTRILKCHVFRCDTPAKAIATSLHEICSKIMAERKNAKALACSSLQERANVNLDVPLQDFPTPKTELVQKFHVQYLGMLPVDKPVGMDILNSAIENLMTSSNKEDWLSVNMNVADATVTVISEKNEEEVLVECRVRFLSFMGVGKDVHTFAFIMDTGNQRFECHVFWCEPNAGNVSEAVQAACMLRYQKCLVARPPSQKVRPPPPPADSVTRRVTTNVKRGVLSLIDTLKQKRPVTEMP
Biochem/physiol Actions
The gene APBB2 (amyloid β precursor protein binding family B member 2), also referred to as FE65-like 1, encodes an adaptor protein that binds to the cytoplasmic domain of β-amyloid precursor protein (βAPP) and processes it to form β-amyloid (Aβ). Over-expression of APBB2 leads to an accumulation of Aβ in senile plaques seen in patients with Alzheimer′s disease (AD). Mutations in this gene have been associated with AD.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51172415
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1409204-50UG
- Temperature Control Device:
- Yes
