Immunogen
Synthetic peptide directed towards the N terminal region of human APOH
Application
Anti-APOH antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
Apolipoprotein H (APOH; beta-2-glycoprotein I) is a phospholipid implicated in lipid metabolism, coagulation and production of antiphospholipid autoantibodies. It functions as a cofactor required for the binding of antiphospholipid antibodies present in the sera of lupus and antiphospholipid syndrome patients.
Sequence
Synthetic peptide located within the following region: LWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGAD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV51158-100UL