Anti-ARG1 (AB2) antibody produced in rabbit

General description

Arginase 1 (Arginase, liver) is a liver enzyme that completes the urea cycle in mammals by producing urea, which can be excreted, and L-ornithine through the hydrolysis of L-arginine. Defects in arginase 1 activity lead to a metabolic condition of hyperargininemia.

Specificity

Anti-ARG1 (AB2) antibody reacts with bovine, human, rabbit, pig, canine, mouse, and rat arginase-1 enzymes.

Immunogen

Synthetic peptide directed towards the C terminal region of human ARG1

Application

Anti-ARG1 (AB2) antibody is used to tag arginase 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of arginase-1 in the management of nitrogen balance within mammalian cells.

Biochem/physiol Actions

Arginase catalyzes the hydrolysis of arginine to ornithine and urea. The type I isoform of ARG1, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.Arginase catalyzes the hydrolysis of arginine to ornithine and urea. At least two isoforms of mammalian arginase exist (types I and II) which differ in their tissue distribution, subcellular localization, immunologic crossreactivity and physiologic function. The type I isoform encoded by this gene, is a cytosolic enzyme and expressed predominantly in the liver as a component of the urea cycle. Inherited deficiency of this enzyme results in argininemia, an autosomal recessive disorder characterized by hyperammonemia.

Sequence

Synthetic peptide located within the following region: LDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.