General description
ARID3b is a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. It plays an essential role in the survival of neural crest during embryogenesis and has recently been associated with the development of neuroblastoma tumors. It has a predicted molecular weight of roughly 60 kDa.
Immunogen
Synthetic peptide directed towards the N terminal region of human ARID3B
Biochem/physiol Actions
ARID3B is a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. The protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer proteins. Members of the ARID family have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Sequence
Synthetic peptide located within the following region: DPRVAPMSNLLPAPGLPPHGQQAKEDHTKDASKASPSVSTAGQPNWNLDE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51283728
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV34275-100UL