General description
ARNTL is a basic helix-loop-helix protein that associates with CLOCK to form a heterodimer. ARNTL may be involved in p53-mediated tumor suppression. Furthermore, ARNTL may be linked to bipolar disorder.
Rabbit Anti-ARNTL (AB1) antibody recognizes bovine, pig, canine, human, mouse, and rat ARNTL.
Immunogen
Synthetic peptide directed towards the N terminal region of human ARNTL
Application
Rabbit Anti-ARNTL (AB1) antibody can be used for IHC (4-8μg/ml, using paraffin-embedded tissues) and western blot (5μg/ml) assays.
Biochem/physiol Actions
ARNTL is a general dimerization partner for a subset of the basic-helix-loop-helix (bHLH)-PER-ARNT-SIM (PAS) superfamily of transcriptional regulators.
Sequence
Synthetic peptide located within the following region: TDYQESMDTDKDDPHGRLEYTEHQGRIKNAREAHSQIEKRRRDKMNSF
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV32002-100UL
