General description
ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila ′atonal,′ a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM
Immunogen
ATOH7 (NP_660161.1, 1 a.a. ~ 152 a.a) full-length human protein.
Sequence
MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT
Physical form
Solution in phosphate buffered saline, pH 7.4
- UPC:
- 41181817
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- SAB1410371-100UG
- Product Size:
- 100/µG