ANTI-ATOH7 ANTIBODY PRODUCED IN RABBIT (C15-1753-240)

Sigma Aldrich

Catalog No.: C15-1753-240
Manufacturer No.: SAB1402054-100UG
Manufacturer Name: Sigma-Aldrich
Quantity: 1
Unit of Measure: EA

Price: $898.29

List Price: $998.10

General description ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila ′:atonal,′: a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).

Enjoy exclusive benefits including discounted pricing on orders by contacting our Sales Executives to open an account. Contact Us

Current Stock:

Quantity:

Adding to cart… The item has been added

Description
Specifications

General description

ATOH7 is a member of the family of basic helix-loop-helix (bHLH) proteins with similarity to Drosophila ′atonal,′ a proneural bHLH gene that controls photoreceptor development (Brown et al., 2002 [PubMed 11889557]).[supplied by OMIM

Immunogen

ATOH7 (NP_660161.1, 1 a.a. ~ 152 a.a) full-length human protein.

Sequence
MKSCKPSGPPAGARVAPPCAGGTECAGTCAGAGRLESAARRRLAANARERRRMQGLNTAFDRLRRVVPQWGQDKKLSKYETLQMALSYIMALTRILAEAERFGSERDWVGLHCEHFGRDHYLPFPGAKLPGESELYSQRLFGFQPEPFQMAT

Physical form

Solution in phosphate buffered saline, pH 7.4

UPC:: 41181817
Condition:: New
Availability:: 3-5 Days
Weight:: 1.00 Ounces
HazmatClass:: No
WeightUOM:: LB
MPN:: SAB1402054-100UG
Product Size:: 100/µG

Cenmed Satisfaction Guarantee

At Cenmed, your confidence and satisfaction are paramount. We guarantee the quality and reliability of our extensive range of clinical and laboratory supplies. If you're not completely satisfied with your purchase, we offer a straightforward return process and dedicated support to resolve your concerns promptly. Our commitment ensures that you can order with confidence, knowing that Cenmed is dedicated to superior service and customer satisfaction. Trust us to meet your needs with every order, backed by our promise of excellence. Learn more in Help & FAQs.

"Cenmed provides me access to the same products/services normally reserved for much larger labs than mine. I was presently surprised by their product offering."