General description
ATPase Na+/K+ transporting subunit Β 3 (ATP1B3) is a 43kDa protein, encoded by the gene mapped to human chromosome 3q23. The encoded protein is a member of subfamily of Na+/K+ -ATPases.
Immunogen
ATP1B3 (NP_001670.1, 1 a.a. ~ 279 a.a) full-length human protein.
Sequence
MTKNEKKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA
Biochem/physiol Actions
ATPase Na+/K+ transporting subunit Β 3 (ATP1B3) suppress enterovirus 71 (EV71) replication by elevating the production of type-I interferons, which might act as a potential target in treatment of EV71 infection. The encoded protein is also involved in the regulation of the immune response. Experimental study suggest that ATP1B3 can control restriction of HIV-1 production and nuclear factor Κ B (NF-ΚB) activation in a bone marrow stromal cell antigen 2 (BST-2) dependent manner. Elevated expression of ATP1B3 has been observed in colon and lung cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51342709
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1410841-100UG
- Temperature Control Device:
- Yes
