Immunogen
Synthetic peptide directed towards the N terminal region of human B3GALT6
Application
Anti-B3GALT6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 (B3GALT6; EDSP2; SEMDJL1) catalyzes the transfer of galactose from UDP-galactose to substrates containing a terminal β-linked galactose moiety. It is localized to Golgi apparatus and is required for glycosaminoglycan synthesis. Aberrations in B3GALT6 gene result in skeletal and connective tissue disorders, collectively known as Ehlers-Danlos syndrome.
Sequence
Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV50258-100UL