Immunogen
Synthetic peptide directed towards the middle region of human BLK
Application
Anti-BLK antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.
Biochem/physiol Actions
BLK, also known as B lymphoid kinase, is a 55kDa tyrosine kinase with SH3, SH2 and catalytic domains that contain consensus sequences of the Src protein tyrosine kinase family. BLK is expressed specifically in the B cell lineage and plays a role in signal transduction pathway that is restricted to B lymphoid cells. Stimulation of resting B-lymphocytes with antibodies to surface immunoglobulin (sIgD or sIgM) induces activation of BLK.
Sequence
Synthetic peptide located within the following region: AVVTKEPIYIVTEYMARGCLLDFLKTDEGSRLSLPRLIDMSAQIAEGMAY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51283219
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV46061-100UL