Immunogen
Synthetic peptide directed towards the N terminal region of human BTNL8
Application
Anti-BTNL8 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
BTNL8 is one of the butyrophilin (BTN)-like molecules that are involved in initiation and regulation of immune responses. BTNL8 augments the antigen-induced activation of T cells and is probably involved in priming of naïve T lymphocytes.
Sequence
Synthetic peptide located within the following region: MALMLSLVLSLLKLGSGQWQVFGPDKPVQALVGEDAAFSCFLSPKTNAEA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV49890-100UL