Immunogen
Synthetic peptide directed towards the middle region of human C3orf10
Application
Anti-C3ORF10 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Biochem/physiol Actions
C3ORF10 (HSPC300) is a protein associated with the organization of actin filaments and cell motility. It interacts with WAVE2 protein and affects the metastatic potential of lung squamous cell carcinoma. Loss of the actin regulation by HSPC300 confers resistance to clear cell renal cell carcinoma in Von Hippel-Lindau patients indicating its role in tumor progression.
Sequence
Synthetic peptide located within the following region: YIEIITSSIKKIADFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181520
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV51212-100UL