General description
C3ORF31 (TAMM41 or TAM41) codes for a mitochondrial translocator assembly and maintenance protein.
Rabbit Anti-C3ORF31 antibody recognizes bovine and human C3ORF31.
Immunogen
Synthetic peptide directed towards the N terminal region of human C3orf31
Application
Rabbit Anti-C3ORF31 antibody is suitable for western blot applications at a concentration of 2.5μg/ml and for IHC using paraffin-embedded tissue at 4-8μg/ml.
Biochem/physiol Actions
C3orf31 may be involved in the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
Sequence
Synthetic peptide located within the following region: QSSWVTFRKILSHFPEELSLAFVYGSGVYRQAGPSSDQKNAMLDFVFTVD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV47715-100UL