General description
The gene encoding chromosome 8 open reading frame 33 (C8orf33) is localized on human chromosome 8q24.
Immunogen
C8orf33 (AAH10001, 1 a.a. ~ 229 a.a) full-length human protein.
Sequence
MAALGHLAGEAAAAPGPGTPCASRGARLPGPVSSARNPSTVCLCPEQPTCSNADSRAHPLGDEGGTASKKQKNKKKTRNRASVANGGEKASEKLAPEEVPLSAEAQAQQLAQELAWCVEQLELGLKRQKPTPKQKEQAIGAIRTLRSKRTPLPRKRQLMHSLFGDYRAQMEAEWREALRALRAAAYSAQVQPVDGATRKKSQRVCRPRSIWRAKATLDMPDEEFRFNFF
Biochem/physiol Actions
Studies have shown that chromosome 8 open reading frame 33 (C8orf33) may have a role in G protein-coupled receptor signaling pathway, Ca2+ signaling and actin cytoskeleton modulation.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51172453
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1407919-50UG
- Temperature Control Device:
- Yes
