General description
The gene CAHD1 (Cache domain-containing protein 1) is mapped to human chromosome 1p31.3.
Immunogen
Synthetic peptide directed towards the N terminal region of human CACHD1
Application
Anti-CACHD1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
CACHD1 (Cache domain-containing protein 1) is a calcium channel protein that is important for excitation-contraction coupling. It is differentially regulated in humans suffering from parkinson disease. CACHD1 is up-regulated in human embryonic stem cells and is down-modulated upon differentiation.
Sequence
Synthetic peptide located within the following region: HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51143215
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV49592-100UL