Immunogen
Synthetic peptide directed towards the N terminal region of human CAV3
Application
Anti-CAV3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
Caveolin-3 is a membrane protein that binds to the Ca(2+)-release channel, RyR1 and facilitates caveolae formation and Ca+2 homeostasis. CAV3 regulates human ether-a-go-go-related gene (hERG) channels that controls cardiac repolarization.
Target description
CAV-3 is a meber of the caveolin family of proteins. It functions as a scaffolding protein caveolin-interacting components and is found highly expressed in muscle.
Sequence
Synthetic peptide located within the following region: MMAEEHTDLEAQIVKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPVG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51341505
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV09021-100UL
