Immunogen
Synthetic peptide directed towards the N terminal region of human CCNL2
Biochem/physiol Actions
CCNL2 belongs to the cyclin family, Cyclin L subfamily. CCNL2 is a transcriptional regulator which participates in regulating the pre-mRNA splicing process. CCNL2 also modulates the expression of critical apoptotic factor, leading to cell apoptosis.
Sequence
Synthetic peptide located within the following region: TGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRRIRDVINVFHR
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352202
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV50695-100UL
