Immunogen
Synthetic peptide directed towards the middle region of human CCR8
Application
Anti-CCR8 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
CCR8 is a mammalian ligand for the chemokine CCL1 and plays an important role in recruitment of T cells and eosinophils in asthma and atopic dermatitis. The role of CCR8 in disease progression has been demonstrated in type I diabetes and autoimmune encephalomyelitis.
Sequence
Synthetic peptide located within the following region: MATIPLLVFYQVASEDGVLQCYSFYNQQTLKWKIFTNFKMNILGLLIPFT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV09059-100UL