Immunogen
Synthetic peptide directed towards the N terminal region of human CENPA
Application
Anti-CENPA antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml and for immunohistochemistry at a concentration of 4-8μg/ml.
Biochem/physiol Actions
Centromere protein A is encoded by gene CENPA which is a Histone H3-like protein that replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. It plays a pivotal role in recruiting and assembly of kinetochore proteins, mitotic progression and chromosome segregation. It acts as a prognostic marker for distant relapse in estrogen receptor-positive breast cancer.
Sequence
Synthetic peptide located within the following region: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51351633
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV46040-100UL