General description

The previously assigned protein identifier A2BDF5 has been merged into P28329. Full details can be found on the UniProt database.

Immunogen

The immunogen for Anti-CHAT antibody: synthetic peptide directed towards the C terminal of human CHAT

Biochem/physiol Actions

CHAT is an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This protein is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer disease. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.

Sequence

Synthetic peptide located within the following region: SSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPS

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.