Immunogen
Synthetic peptide directed towards the N terminal region of human CHIC2
Application
Anti-CHIC2 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.
Biochem/physiol Actions
CHIC2 (cysteine-rich hydrophobic domain 2) gene encodes for a 165 amino acid containing membrane protein that belongs to the CHIC family. CHIC2 is associated with vesicular structures and the plasma membrane, signifying that it may regulate exocytosis. CHIC2 gene is also involved in a chromosomal translocation occurring in acute myeloid leukemias.
Sequence
Synthetic peptide located within the following region: EEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASI
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51282914
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV46856-100UL