Immunogen
Synthetic peptide directed towards the middle region of human CHST14
Application
Anti-CHST14 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Carbohydrate (N-acetylgalactosamine 4-0-sulfotransferase 14, CHST14; D4ST1) catalyzes the transfer of sulfate to the C-4 hydroxyl of N-acetylgalactosamine residues in dermatan sulfate.CHST14 regulates the proliferation and neurogenesis process in neural progenitor cells. Mutations in CHST14 gene causes adducted thumb-clubfoot syndrome.
Sequence
Synthetic peptide located within the following region: REYQQRYGAEIVRRYRAGAGPSPAGDDVTFPEFLRYLVDEDPERMNEHWM
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51473303
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV48994-100UL