General description
COBLL1, a negative regulator of apoptosis in cultured tumor cells, has been identified as a component of a robust predictive four gene ratio test for survival of patients with malignant pleural mesothelioma.
The previously assigned protein identifier A6NMZ3 has been merged into Q53SF7. Full details can be found on the UniProt database.
Specificity
Anti-COBLL1 polyclonal antibody reacts with human, mouse, rat, and canine COBL-like 1 proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human COBLL1
Application
Anti-COBLL1 polyclonal antibody is used to tag COBL-like 1 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a prognostic indicator for malignant pleural mesothelioma.
Biochem/physiol Actions
The function remains known.
Sequence
Synthetic peptide located within the following region: SAPATPLVNKHRPTFTRSNTISKPYISNTLPSDAPKKRRAPLPPMPASQS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV42423-100UL