General description
CORO1A is a WD-repeat protein that has been implicated in Mycobacterium leprae infection. Studies have reported that CORO1A localizes on the membrane of phagosomes that contain M. leprae, where Toll-like receptor (TLR) 2 is also present. CORO1A suppresses TLR-mediated signaling in human macrophages.
Rabbit Anti-CORO1A recognizes bovine, rat, rabbit, mouse, human, and canine CORO1A.
Immunogen
Synthetic peptide directed towards the C terminal region of human CORO1A
Application
Rabbit Anti-CORO1A can be used for western blot applications at a concentration of 1.25 μg/ml.
Biochem/physiol Actions
CORO1A forms homodimers. It plays a role in the cross-linking of F-actin in the cell.
Sequence
Synthetic peptide located within the following region: TGRRRAAPEASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAK
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51283200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV34285-100UL