Immunogen
Synthetic peptide directed towards the N terminal region of human CPA1
Application
Anti-CPA1 antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions
CPA1 (Carboxypeptidase A1) is a zinc metalloenzyme belonging to the tetragonal space group P4(3)2(1)2. It forms a multiprotein complex, Zn2+-poly(acrylic acid), by directly interacting with proteases in the gastrointestinal tract. It stimulates the hydrolytic separation of carboxyl-terminal aromatic or branched aliphatic side chain of amide bonds from peptides and proteins.
Sequence
Synthetic peptide located within the following region: QVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPIDVRVPFPSIQ
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51124100
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV33859-100UL