Immunogen
Synthetic peptide directed towards the C terminal region of human CSDA
Application
Anti-CSDA (AB2) antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml.
Biochem/physiol Actions
CSDA is a member of RNA-and DNA-binding cold-shock-domain (CSD) family that regulates the concentration of EGR1 to mediate luteinizing hormone β subunit transcription. It regulates Bcr-Abl effector, and also regulates cell proliferation and transformation in chronic myeloid leukemia.
Sequence
Synthetic peptide located within the following region: GPPRPRPAPAVGEAEDKENQQATSGPNQPSVRRGYRRPYNYRRRPRPPNA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41105328
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV100917-100UL