ANTI-CUGBP2 (C15-1341-218)

General description

CUGBP2 (ETR-3/NAPOR/BRUNOL3) is an RNA-binding protein, posttranscriptional controller of gene expression, that regulates key cellular responses such as apoptosis by binding to AU-rich sequences in the mRNA of important genes such as COX-2 and VEGF. CUGBP2 is a critical regulator of the apoptotic response to genotoxic injury in breast cancer cells and mitotic catastrophe response.

Specificity

Anti-CUGBP2 polyclonal antibody reacts with chicken, human, mouse, rat, canine, bovine, and zebrafish RNA binding protein 2 proteins.

Immunogen

Synthetic peptide directed towards the N terminal region of human CUGBP2

Application

Anti-CUGBP2 polyclonal antibody is used to tag RNA binding protein 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of RNA binding protein 2 in the regulation of posttranslational gene transcription in response to gentotoxic injury.

Biochem/physiol Actions

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation.Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Sequence

Synthetic peptide located within the following region: VYQINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNIKTLPGMHHP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.