General description
The previously assigned protein identifier B5MCS6 has been merged into B5MC82. Full details can be found on the UniProt database.
Immunogen
Synthetic peptide directed towards the N terminal region of human DDT
Biochem/physiol Actions
D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. It is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22.
Sequence
Synthetic peptide located within the following region: PFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352200
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB2100547-100UL