Immunogen
Synthetic peptide directed towards the middle region of human DNER
Application
Anti-DNER antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.
Biochem/physiol Actions
Delta/notch-like EGF repeat containing (DNER) is a non-canonical Notch ligand expressed in developing and adult neurons. It may be involved in the differentiation of neurospheres in vitro and in vivo and in the regulation of neuritogenesis.
Sequence
Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51144201
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV50777-100UL