Immunogen
Synthetic peptide directed towards the C terminal region of human DOK1
Application
Anti-DOK1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.25 μg/ml.
Biochem/physiol Actions
DOK1 is a tumor suppressor protein that is repressed by hypermethylation in a variety of human tumors. DOK1 transcription is regulated by E2F1 transcription factor and is important during cellular stress and etoposide-induced DNA damage. DOK1 is the critical mediator of stress-induced cell death. Inactivation of DOK1 is a frequent feature in head and neck cancers.
Sequence
Synthetic peptide located within the following region: EPGTATGSGIKSHNSALYSQVQKSGASGSWDCGLSRVGTDKTGVKSEGST
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116126
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV09001-100UL