Immunogen
Synthetic peptide directed towards the middle region of human DONSON
Biochem/physiol Actions
This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.This gene lies downstream of the SON gene and spans 10 kb on chromosome 21. The function of this gene is unknown.
Sequence
Synthetic peptide located within the following region: DLITALISPTTRGLREAMRNEGIEFSLPLIKESGHKKETASGTSLGYGEE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV45862-100UL