General description
Developmentally regulated GTP binding protein 1 (DRG1) is a a guanine nucleotide binding protein that functions as a potassium-dependent GTPase. It is upregulated by Lerepo4.
Rabbit Anti-DRG1 antibody recognizes human, mouse, rat, bovine, zebrafish, chicken, and rabbit DRG1.
Immunogen
Synthetic peptide directed towards the middle region of human DRG1
Application
Rabbit Anti-DRG1 antibody is suitable for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
DRG1 belongs to the GTP1/OBG family.It may play a role in cell proliferation, differentiation and death.
Sequence
Synthetic peptide located within the following region: VLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSEL
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51183300
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV48240-100UL
