General description
In addition to antigen recognition by the T-cell receptor, T-cell activation requires a second signal from a costimulatory receptor, such as CD28 (MIM 186760), which interacts with B7-1 (CD80; MIM 112203) and B7-2 (CD86; MIM 601020) ligands on antigen-presenting cells. CD28 costimulation induces transcription of interleukin-2 (IL2; MIM 147680) and stabilizes newly synthesized IL2 through the activation of mitogen-activated protein kinases (MAPKs), such as ERK (e.g., MAP2K4; MIM 601335) and JNK (see MIM 601158), and the subsequent creation of AP1 transcription factor (see MIM 165160). DUSP14 is a negative regulator of CD28 signaling.[supplied by OMIM
Immunogen
DUSP14 (NP_008957.1, 1 a.a. ~ 198 a.a) full-length human protein.
Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNATIEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSATLCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGIVPDVYEKESRHLMPYWGI
Application
Anti-DUSP14 antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions
DUSP14 (Dual specificity phosphatase 14) is associated with several critical signaling pathways. It has ability to dephosphorylate both phosphotyrosine and phosphoserine/phosphothreonine residues on substrates. DUSP14 controls MAPK (mitogen-activated protein kinase) signaling pathway by dephosphorylating MAPK proteins ERK (extracellular-signal-regulated kinase), JNK (c-Jun N-terminal kinase) and p38. It has been reported that DUSP14 participates in T cell proliferation as a negative-feedback regulator.
Physical form
Solution in phosphate buffered saline, pH 7.4
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51202000
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB1408665-100UG
- Temperature Control Device:
- Yes