General description
ELOVL7 (Elongation of very long chain fatty acids protein-7) is widely expressed, except for heart and skeletal muscle tissues. It belongs to ELOVL family of proteins.
Immunogen
Synthetic peptide directed towards the N terminal region of human ELOVL7
Application
Anti-ELOVL7 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
Biochem/physiol Actions
Elongation of very long chain fatty acids protein-7 (ELOVL7) is a very long-chain fatty acid elongase with high activity towards acyl-CoA. It plays an important role in lipid metabolism of prostate cancer cells and might be the link between fat dietary intake and carcinogenesis.
Sequence
Synthetic peptide located within the following region: MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41116127
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV49908-100UL