General description
ERF is a transcription factor that belongs to the ETS family of proteins and regulates cell growth. Reduced ERF dosage has been linked to complex craniosynostosis in humans.
Rabbit Anti-ERF antibody recognizes human, mouse, rat, and zebrafish ERF.
Immunogen
Synthetic peptide directed towards the C terminal region of human ERF
Application
Rabbit Anti-ERF antibody can be used for western blot applications at a concentration of 1μg/ml.
Biochem/physiol Actions
Members of the ETS family of transcription factors, such¡¡as ERF, regulate cell proliferation and differentiation. They share¡¡a highly conserved DNA-binding domain, the ETS domain, that¡¡recognizes the sequence GGAA/T.Members of the ETS family of transcription factors, such as ERF, regulate cell proliferation and differentiation. They share a highly conserved DNA-binding domain, the ETS domain, that recognizes the sequence GGAA/T (de Castro et al., 1997 [PubMed 9192842]). For further information on ETS transcription factors, see ETS1 (MIM 164720).[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-56 DC299706.1 1-56 57-2698 BC022231.1 1-2642 2699-2705 BM905776.1 207-213
Sequence
Synthetic peptide located within the following region: GGLAEGAGALAPPPPPPQIKVEPISEGESEEVEVTDISDEDEEDGEVFKT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41105328
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV31651-100UL