Immunogen
Synthetic peptide directed towards the N terminal region of human ESRRG
Application
Anti-ESRRG antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Estrogen-related receptor gamma (ESRRG) is an orphan nuclear receptor that belongs to the estrogen receptor-related receptor family. ESRR family members have the same set of target genes and regulators as the estrogen receptors. ESRRG acts as a transcriptional activator of DNA cytosine-5-methyltransferases 1 and modulates cell proliferation, osteoblast differentiation and bone formation and energy metabolism in human trophoblasts. Studies indicate that this receptor mediates antidiabetic effect as it inhibits hepatic gluconeogenesis.
Sequence
Synthetic peptide located within the following region: DRHIDSSCSSFIKTEPSSPASLTDSVNHHSPGGSSDASGSYSSTMNGHQN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV45602-100UL