General description
ETS1 belongs to the Ets family of transcription factors that are crucial mediators of extracellular matrix remodeling. The Ets family members are regulators of bone and cartilage development.
Immunogen
Synthetic peptide directed towards the N terminal region of human ETS1
Application
Anti-ETS1 antibody produced in rabbit is suitable for western blotting at a concentration of 1 μg/ml. For immunohistochemistry of paraffin-embedded tissue sections, a concentration of 4-8 μg/ml is suitable.
Biochem/physiol Actions
The DNA-binding activity of ETS1 requires the phosphorylation at Thr38 by ERK1/2. ETS1 is expressed in a variety of cell types including hematopoietis cells, endothelial cells, epithelial cancer cells and vascular smooth muscle cells. ETS1 promotes cell invasion and angiogenesis as it regulates the transcription of VEGF and MMP genes.
Sequence
Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV100604-100UL