General description
Extradenticle (EXD) is a Drosophila transcription factor that regulates brain and eye development. It modulates the transcription network in the dorsal retinal rim and the FGF/branchless expression in mesodermal bridge cells.
Rabbit Anti-EXD antibody recognizes mouse, and rat EXD.
Immunogen
Synthetic peptide corresponding to a region of Fruit fly
Application
Rabbit Anti-EXD antibody is suitable for western blot applications at a concentration of 5μg/ml.
Biochem/physiol Actions
As a transcription factor, exd acts with the selector homeodomain proteins altering the regulation of downstream target genes such as wingless, teashirt and decapentaplegic. Thus exd affects segmental identity.
Sequence
Synthetic peptide located within the following region: EAKEELARKCGITVSQVSNWFGNKRIRYKKNIGKAQEEANLYAAKKAAGA
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352203
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV47897-100UL