Immunogen
Synthetic peptide directed towards the C terminal region of human FAAH2
Biochem/physiol Actions
Fatty acid amide hydrolases, such as FAAH1 and FAAH2, hydrolyze primary fatty acid amide substrates and may play a role in fatty acid catabolism.Fatty acid amide hydrolases, such as FAAH1 (FAAH; MIM 602935) and FAAH2, hydrolyze primary fatty acid amide substrates (e.g., oleamide) and may play a role in fatty acid catabolism (Wei et al., 2006 [PubMed 17015445]).[supplied by OMIM].
Sequence
Synthetic peptide located within the following region: SPLWELIKWCLGLSVYTIPSIGLALLEEKLRYSNEKYQKFKAVEESLRKE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201516
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV53305-100UL