Immunogen
Synthetic peptide directed towards the C terminal region of human FAM3C
Application
Anti-FAM3C antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
FAM3C belongs to the family with sequence similarity 3 (FAM3) family and is a secreted cytokine that promotes epithelial to mesenchymal transition, metastasis and tumor formation in the epithelial cells. The activity of FAM3C is essential for formation of retinal lamina and the development of retina.
Sequence
Synthetic peptide located within the following region: DNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQD
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV44904-100UL