General description
The previously assigned protein identifier E9QP06 has been merged into Q7TPD1. Full details can be found on the UniProt database.
Immunogen
The immunogen for anti-FBXO11 antibody: synthetic peptide directed towards the C terminal of human FBXO11
Sequence
Synthetic peptide located within the following region: RRNKIHDGRDGGICIFNGGRGLLEENDIFRNAQAGVLISTNSHPVLRKNR
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Shipping Information:
Dry Ice Surcharge & Ice Pack Shipments: $40
More Information: https://cenmed.com/shipping-returns
- UPC:
- 51204100
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- SAB2108403-100UL
- Temperature Control Device:
- Yes
