Immunogen
Synthetic peptide directed towards the middle region of human FEM1B
Application
Anti-FEM1B (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
FEM1B [fem-1 homolog b (C. elegans)] gene encodes a protein which is a homolog of feminization-1 (FEM-1), a protein involved in the sex-determination pathway of the nematode Caenorhabditis elegans. It stimulates ubiquitylation of Gli1 as well as inhibits its transcriptional activity. It is a proapoptotic protein that facilitates proteasome inhibitor-induced apoptosis of human colon cancer cells. Additionally, FEM1B serves as an adapter or mediator protein that links CHK1 and Rad9 and facilitates checkpoint signaling induced by replication stress.
Sequence
Synthetic peptide located within the following region: FQDGDNILEKEVLPPIHAYGNRTECRNPQELESIRQDRDALHMEGLIVRE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51313802
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV53702-100UL