General description
Facio-genital dysplasia protein (FGD1) is an upstream regulator of Rho GTPases and is involved in the normal development of embryos. It is also known to function as a guanine-nucleotide exchange factor which is specific for Cdc42Hs. FGD1 mutations have been implicated in Aarskog syndrome.
Rabbit Anti-FGD1 antibody recognizes canine, bovine, human, mouse, and rat FGD1.
Immunogen
Synthetic peptide directed towards the C terminal region of human FGD1
Application
Rabbit Anti-FGD1 antibody has been used for western blotting assays at a concentration of 2.0μg/ml.
Biochem/physiol Actions
FGD1 contains Dbl (DH) and pleckstrin (PH) homology domains. It can bind specifically to the Rho family GTPase Cdc42Hs and stimulate the GDP-GTP exchange of the isoprenylated form of Cdc42Hs. It also stimulates the mitogen activated protein kinase cascade leading to c-Jun kinase SAPK/JNK1 activation. FGD1 has an essential role in embryonic development, and FGD1 gene mutations result in the human developmental disorder, Aarskog-Scott syndrome.
Sequence
Synthetic peptide located within the following region: WMAVLGRAGRGDTFCPGPTLSEDREMEEAPVAALGATAEPPESPQTRDKT
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51111849
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV31673-100UL
