Immunogen
Synthetic peptide directed towards the C terminal region of human FIBCD1
Application
Anti-FIBCD1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Biochem/physiol Actions
Fibrinogen C domain containing 1 (FIBCD1) is a tetrameric transmembrane endocytic receptor that is localized to the intestinal brush border. It binds to chitin and chitin fragments and is important for immune responses against parasites and fungi.
Sequence
Synthetic peptide located within the following region: DGYPLTVADYSGTAGDSLLKHSGMRFTTKDRDSDHSENNCAAFYRGAWWY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51201651
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV50135-100UL
