Immunogen
Synthetic peptide directed towards the N terminal region of human FJX1
Application
Anti-FJX1 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/mL.
Biochem/physiol Actions
FJX1 [four jointed box 1 (Drosophila)] gene encodes for a protein, which is the human ortholog of mouse and drosophila four-jointed gene product that belongs to FJX1/FJ family. Rodent four-jointed ortholog Fjx1 facilitates the regulation of dendrite extension.
Sequence
Synthetic peptide located within the following region: MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 12352207
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV47013-100UL