Immunogen
Synthetic peptide directed towards the N terminal region of human FMO3
Application
Anti- FMO3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.
Biochem/physiol Actions
FMO3 belongs to the Flavin-containing monooxygenases (FMO) family of drug-metabolizing enzymes that catalyze the oxidation of various xenobiotics. FMO3 is a transmembrane protein present in the endoplasmic reticulum. Mutations in gene encoding FMO3 causes trimethylaminuria or fish odor syndrome.
Sequence
Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 51172414
- Condition:
- New
- Availability:
- 3-5 Days
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- MPN:
- AV44434-100UL