Immunogen

Synthetic peptide directed towards the N terminal region of human FMO3

Application

Anti- FMO3 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml.

Biochem/physiol Actions

FMO3 belongs to the Flavin-containing monooxygenases (FMO) family of drug-metabolizing enzymes that catalyze the oxidation of various xenobiotics. FMO3 is a transmembrane protein present in the endoplasmic reticulum. Mutations in gene encoding FMO3 causes trimethylaminuria or fish odor syndrome.

Sequence

Synthetic peptide located within the following region: FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.