General description
FOXF1 is a transcription factor that is induced upon p53-dependent DNA damage. Studies have reported that this transcription factor may act as a p53 target. FOXF1 may also regulate the invasion and migration of cancer cells.
Rabbit Anti-FOXF1 recognizes human FOXF1.
Immunogen
Synthetic peptide directed towards the N terminal region of human FOXF1
Application
Rabbit Anti-FOXF1 can be used for western blot applications at 1.25μg/ml.
Biochem/physiol Actions
FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development.
Sequence
Synthetic peptide located within the following region: MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
- UPC:
- 41181888
- Condition:
- New
- Weight:
- 1.00 Ounces
- HazmatClass:
- No
- WeightUOM:
- LB
- MPN:
- AV31691-100UL