Immunogen

Synthetic peptide directed towards the N terminal region of mouse FOXI1

Biochem/physiol Actions

Mouse Foxi class genes may play important roles, both during cranial placode specification and in later development of individual cranial sensory structures and other organs derived from the cranial ectoderm

Sequence

Synthetic peptide located within the following region: SIGQEPPEMNLYYENFFHPQGMPSPQRPTSFEGGGEYGTTPNPYLWFNGP

Physical form

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Disclaimer

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.